PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 611aa    MW: 69304.1 Da    PI: 5.0608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030989.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.8e-162572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
      CCG030989.1 25 KGLWSPEEDEKLIKYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 72
                     678*******************************************97 PP

2Myb_DNA-binding52.98.7e-1778122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el++++++ lG++ W+ Ia++++ gRt++++k++w++ 
      CCG030989.1  78 RGAFSPQEEELIIHLHTILGNR-WSQIAARLP-GRTDNEIKNFWNST 122
                      89********************.*********.***********986 PP

3Myb_DNA-binding24.56.3e-083774002347
                      -HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  23 tWktIartmgkgRtlkqcksrwqky 47 
                      +W+ Ia++++ gRt++++k++w++ 
      CCG030989.1 377 RWSQIAARLP-GRTDNEIKNFWNST 400
                      5*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6442072IPR017930Myb domain
SuperFamilySSF466892.06E-2822119IPR009057Homeodomain-like
SMARTSM007171.2E-122474IPR001005SANT/Myb domain
PfamPF002493.3E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-232679IPR009057Homeodomain-like
CDDcd001673.52E-102872No hitNo description
PROSITE profilePS5129425.84773127IPR017930Myb domain
SMARTSM007175.3E-1677125IPR001005SANT/Myb domain
PfamPF002491.5E-1478122IPR001005SANT/Myb domain
CDDcd001677.84E-1180123No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2680127IPR009057Homeodomain-like
SMARTSM007170.28309403IPR001005SANT/Myb domain
PROSITE profilePS500906.748365401IPR017877Myb-like domain
SuperFamilySSF466891.27E-8366411IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-12373402IPR009057Homeodomain-like
CDDcd001672.02E-5377401No hitNo description
PfamPF002496.0E-6377400IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MRKPDLVGKD RVPSNSSINK ARLRKGLWSP EEDEKLIKYM LTNGQGCWSD IARNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHTILGNRW SQIAARLPGR TDNEIKNFWN  120
STLKKRLKIN NTSTSSPNDS DSSEPRDHAV GNIMPMHDPD IMTLCMDSSS SSSISMQGMI  180
TSNQFDSFSM LNNRYDVTGA ASLFDMSTCL TQVGMGDGFY GDHYGILEAN NKTGLESDLS  240
LPPLESRSFE ENNTVSNNRI GMKSSSSSNN NNCFDNACFD NTFFNNTDQR FKVEDMLGLE  300
NHWQGENLRM GEWDFEESVQ KQDEKRKEMY ILPSRERNKR VLIPSFSAFS ITKMHALNIY  360
MDTCLLQTHS YVFKQSRWSQ IAARLPGRTD NEIKNFWNST LKKRLKINNT STSSPNDSDS  420
SEPRDHAVGN IMPMHDPDIM TLCMDSSSSS SISMQGMITS NQFDSFSMLN NRYDVTGAAS  480
LFDMSTCLTQ VGMGDGFYGD HYGILEANNK TGLESDLSLP PLESRSFEEN NTVSNNRIGM  540
KSSSSSNNNN CFDNACFDNT FFNNTDQRFK VEDMLGLENH WQGENLRMGE WDFEGLMENI  600
TSFPLLDFQV E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27231275108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486760.0KF148676.1 Populus trichocarpa MYB transcription factor (MYB20) mRNA, complete cds.
GenBankKT2613410.0KT261341.1 Fraxinus mandshurica transcription factor MYB2 (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025434.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0S3G5C10.0A0A0S3G5C1_9LAMI; Transcription factor MYB2
TrEMBLB9HNP30.0B9HNP3_POPTR; MYB transcription factor
STRINGPOPTR_0009s06630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-69myb domain protein 83